'Provide Support' Websites

- livezilla.net

LiveZilla Live Support Software featuring Live Chats, Real Time Visitor Monitoring, Online Customer Support, Ticket System, WebCam Chats and Operator to Operator Chats.

146,037 $ 82,200.00

- livezilla.com

LiveZilla Live Support Software featuring Live Chats, Real Time Visitor Monitoring, Online Customer Support, Ticket System, WebCam Chats and Operator to Operator Chats.

3,365,711 $ 480.00

- kennedysdisease.org

Kennedy's Disease Association. Please Help Us by Supporting Research, Sharing Information, Providing Support and Increasing Awareness'

5,061,802 $ 240.00

- livechatoo.com

Live Chat Support, Sales Support Software, Live Chat Software and Help Centre with FAQ for Your Website and Customers. Online Support - Chat.

1,033,636 $ 1,200.00

- theonlinehelpsite.com

Live Help, Live Support, Customer Support,, Online Help Site

Not Applicable $ 8.95

- talkagent.net

An offshore outsourcing customer service center providing outsourced live chat and email support representatives for your e-commerce initiatives. Choose from Pay Per Chat, Monthly and Per Hour Service

Not Applicable $ 8.95

- livezilla.help

LiveZilla Live Support Software featuring Live Chats, Real Time Visitor Monitoring, Online Customer Support, Ticket System, WebCam Chats and Operator to Operator Chats.

Not Applicable $ 8.95

- frmerchantandco.com

ProvideSupport: Live Help, Live Support Software, Live Chat service and website monitoring - All for Customer Support and Live Assistance

Not Applicable $ 8.95

- newszilla.net

LiveZilla Live Support Software featuring Live Chats, Real Time Visitor Monitoring, Online Customer Support, Ticket System, WebCam Chats and Operator to Operator Chats.

Not Applicable $ 8.95

- arlivesupport.com

ProvideSupport: Live Help, Live Support Software, Live Chat service and website monitoring - All for Customer Support and Live Assistance

Not Applicable $ 8.95

- livezilla.de

LiveZilla ermöglicht Ihnen Kunden auf Ihrer Webseite per Live Chat zu beraten und zeigt Ihnen alle Besucher in Echtzeit an. Verwandeln Sie Besucher in Kunden - mit LiveZilla.

Not Applicable $ 8.95

- inmysafehaven.com

Peace & Serenity in My Safe Haven is a nonprofit catering to young women in Chicago, IL. Contact us today to learn more about our services.

Not Applicable $ 8.95

- peaceandserenityinmysafehaven.com

Peace & Serenity in My Safe Haven is a nonprofit catering to young women in Chicago, IL. Contact us today to learn more about our services.

Not Applicable $ 8.95

- paytoncounselingservices.org

Payton Counseling Services LLC in Danbury, CT offers marriage, individual, and family counseling services. Contact us today.

Not Applicable $ 8.95

- providesupport.xyz

Premium Domain ProvideSupport.xyz Is Now On Sale.

Not Applicable $ 8.95