GORDELIK GmbH : Start Webseite Gordelik

- chiefcustomerofficer.biz

GORDELIK GmbH | Personal Recruiting | Call Center | Finance | eBusiness | Direktmarketing | Personalberatung | Executive Search | Diagnostik

Not Applicable $ 8.95


g-assist.com

- g-assist.com

g-assist.com The Virtual Assistant free blog

Not Applicable $ 8.95

Work at Home Jobs | Work at Home Opportunities

- onestopwebemployment.com

Work at Home Jobs | Work at Home Opportunities-Offering work at home jobs, free job leads, telecommute job listings, work at home articles, legitimate telecommute companies, free advertising resources, home business ideas, and more. Everything to get started to work at home.

1,634,071 $ 480.00

Welcome to the Happiness Project

- happiness.co.uk

The Happiness Project - Official Website of Dr. Robert Holden and The Happiness Project - as featured in the award winning BBC documentary How to be Happy

2,458,127 $ 240.00

neopost-assistance.com

- neopost-assistance.com

neopost-assistance.com The Virtual Assistant free blog

Not Applicable $ 8.95

Trainer's Toolchest | Employee Training Video Courses on Sexual Harass

- trainerstoolchest.com

Trainer's Toolchest - a leading provider of human resource training materials to businesses, educational institutions, NGO, government, healthcare organizations.

Not Applicable $ 8.95

Home » EXtreme Tracking and Routing Application | Elite EXTRA

- eliteextra.com

Route, track, optimize, and manage drivers, service techs, and deliveries through affordable cloud-based dispatch management software that provides real-time ETAs and shows where your mobile resources are at all times. B2B or B2C, float your fleet, and streamline every mile -- first mile, last mile, and every mile in b

417,239 $ 9,720.00

EggXpert

- eggxpert.com

The official Newegg tech support community and Newegg tech support forums. Learn about PC building, case mods, computer repairs, and computer troubleshooting. Get help from knowledgable community members about computer hardware and computer software, laptops, notebooks, netbooks, consumer electronics & mp3 players, hom

146,993 $ 46,800.00

Net Idea - Dial-Up, High Speed, Web Hosting - Internet Solutions with

- netidea.com

Net Idea provides quality internet solutions with personal service. We offer fast dial-up internet, high speed ADSL, web hosting, server co-location, website development and domain name registration backed by our famous customer service and technical support.

Not Applicable $ 8.95

Call Center Outsourcing Company | White Glove Customer Service

- directinteractions.com

We're a call center outsourcing company in Seattle that offers best-in-class, white glove customer service that is consistent, flexible, and is cost-efficient.

4,015,401 $ 240.00

California fulfillment warehouse, Los Angeles fulfillment company, ful

- medallionenterprises.com

Medallion Fulfillment and Logistics is your California fulfullment warehouse and the premiere Los Angeles fulfillment company. Located in the greater Los Angeles, California metro area, we provide product fulfillment warehouse services and supply chain management, shipping, warehousing, and logistics nationally, on the

6,226,727 $ 240.00

Stephanie Fierman - Marketing Observations Grown Daily

- stephaniefiermanmarketingdaily.com

Marketing guru Stephanie Fierman blogs about the art and science of connecting with consumers.

Not Applicable $ 8.95

Vin Du Vin - Where the Wine Is.

- vinduvin.com

Vin Du Vin brings wine lovers and wineries together together in a way that no other wine site has ever done before;Locate any winery using our winery locator, travel to wine country, and purchase our online wine maps..

17,400,198 $ 8.95

HR Indexx - Human Resources, Recruitment and Training

- hrindexx.com

HR Indexx building organisations and shaping lives

Not Applicable $ 8.95

Welcome to PemTel - Home

- pemtel.com

PemTel provides Local Telephone Services; Long Distance Telephone Services, High Speed Internet Service, Cable TV Services, Emergency Response Services and more to residents of Giles and Craig Counties in Virginia.

Not Applicable $ 8.95

Peacock Productions

- peacockproductions.com

Peacock Productions is a #1 source for seminars, books, and training materials on Diversity, Customer Service, Personal Accountability, and Creativity and Organizational Change - all by best-selling author and speaker BJ Gallagher Hateley.

Not Applicable $ 8.95

Reliable Hosting.com

- oakweb.com

Reliable and affordable hosting of high volume and low volume websites. Websites plans starting at $15 a month or $100 a year. Colo servers available.

Not Applicable $ 8.95

MTB & road bike spare parts, MTB components, Wheels, Frames, SHIMANO,

- rczbikeshop.com

MTB & road bike spare parts, everything can be found at RCZ, your online spare parts shop RCZ, specialised in components, accessories, bike clothing, MTB & Road bike service; but as well a personalised multi-lingual customer service, 1 euro swift delivery, secured payment system, advices et before all: the lowest price

753,555 $ 1,680.00

Blackjag ITES - An Established Business Process Outsourcing Company

- blackjagites.com

Blackjag is an established Business Process Outsourcing (BPO) company, with a skill set of professionally qualified and dedicated people that can deliver the ideal back office or Front office outsourcing solution.

Not Applicable $ 8.95

Powerlink CRM | מערכת לניהול קשרי לקוחות וצוותי מכירות

- powerlink.co.il

תוכנה לניהול קשרי לקוחות, מערכת חכמה לניהול מוקד שירות ומכירות. קליטת לידים אוטומטית, מעקב ובקרה על יומן הפגישות והמשימות בעסק, תוכנת CRM לניהול מכירות מכל מקום.

218,381 $ 41,040.00


Earolyn Creative Services|Home

- earolyn.biz

Presentation Design, Desktop Publishing, Photography, Creative & Administrative Tasks Management Services for Print & Digital Media projects.

Not Applicable $ 8.95